PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G201800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 295aa    MW: 32016.8 Da    PI: 9.7608
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G201800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.3e-16122168248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         g WT+eEd +l+ av+++G + W+ Iar    gR +kqc++rw ++l
  Brast08G201800.1.p 122 GTWTKEEDNILKAAVNEFGERKWAMIARSYLPGRIGKQCRERWINHL 168
                         79*************************98877************996 PP

2Myb_DNA-binding52.89.3e-17175216245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         g WT+ Ed+ lvda++  G++ W+ Ia++++ gR+++++k++w+
  Brast08G201800.1.p 175 GMWTEAEDLELVDAHRTCGNR-WSVIAKRLP-GRSENSVKNHWN 216
                         57*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.474116172IPR017930Myb domain
SuperFamilySSF466893.03E-29119215IPR009057Homeodomain-like
SMARTSM007173.5E-14120170IPR001005SANT/Myb domain
PfamPF002498.4E-14122168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-24122175IPR009057Homeodomain-like
CDDcd001675.94E-15123168No hitNo description
PROSITE profilePS5129416.256173223IPR017930Myb domain
SMARTSM007171.1E-12173221IPR001005SANT/Myb domain
PfamPF002492.9E-15175216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-20176218IPR009057Homeodomain-like
CDDcd001677.43E-13177216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRLQLSLPF LPPLARPLIP PLQNSHHRCS IPTSKPGLMA AGHEFFMDLE QAAAMDKAAM  60
GKYLSLGISG LGGGVACPNN SAAPATFFGF GGGALPVDAM TAPAPPPPGA PGAVEDVERF  120
NGTWTKEEDN ILKAAVNEFG ERKWAMIARS YLPGRIGKQC RERWINHLHP NIKNGMWTEA  180
EDLELVDAHR TCGNRWSVIA KRLPGRSENS VKNHWNATRR GLRARRLLKK RSSKRQPCPG  240
RLSHLAHYIS TLYPPPPSAA AASLSPPLLP VQEHEDQLQA QDGDGLVHLS LCLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-341202186103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.14e-56PREDICTED: uncharacterized protein LOC101784221
TrEMBLA0A0Q3J3W14e-94A0A0Q3J3W1_BRADI; Uncharacterized protein
STRINGSi004755m1e-55(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.16e-37myb domain protein 98